PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00004.265
Common NameAMTR_s00004p00265170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 733aa    MW: 80285.2 Da    PI: 5.3639
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00004.265genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.75.6e-2051106156
                                               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                               +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R++ k
  evm_27.model.AmTr_v1.0_scaffold00004.265  51 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQVK 106
                                               678899**********************************************9877 PP

2START213.86.2e-672414631206
                                               HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHH CS
                                     START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlal 60 
                                               ela +a++el+++a+++ep+W   +    e + ++e++++f+++ +      + ea+r+++vv+m++ +
  evm_27.model.AmTr_v1.0_scaffold00004.265 241 ELAVAAMEELIRMAQLGEPLWIPGVedptEVLCEEEYIRTFPRGIGprpfgLKLEASRETAVVIMNPIN 309
                                               57899****************887777799999**********999*********************** PP

                                               HHHHHCCCGGCT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE. CS
                                     START  61 lveellddkeqWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirql 118
                                               lv +l+d++ qW+  +     +a tl+v s+g      galq+m+ae+q+++plvp R+++fvRy++q+
  evm_27.model.AmTr_v1.0_scaffold00004.265 310 LVDILMDVN-QWSSVFYgvisRAFTLDVFSTGvagnynGALQVMSAEFQVPTPLVPtRESYFVRYCKQH 377
                                               *********.*********************************************************** PP

                                               TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHH CS
                                     START 119 gagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvks 187
                                               ++g+w++vdvS+ds ++ p+   + R++++pSg+li++++ng+skvtwvehv++++r +h+++r+lv+s
  evm_27.model.AmTr_v1.0_scaffold00004.265 378 SDGTWAVVDVSLDSLRPSPQ--AMQRCRRRPSGCLIHEMPNGYSKVTWVEHVEVDDRAVHNIYRPLVNS 444
                                               ******************96..9********************************************** PP

                                               HHHHHHHHHHHHTXXXXXX CS
                                     START 188 glaegaktwvatlqrqcek 206
                                               gla+gak+wvatl+rqce+
  evm_27.model.AmTr_v1.0_scaffold00004.265 445 GLAFGAKRWVATLDRQCER 463
                                               *****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-223092IPR009057Homeodomain-like
SuperFamilySSF466892.38E-1938108IPR009057Homeodomain-like
PROSITE profilePS5007116.8648108IPR001356Homeobox domain
SMARTSM003891.8E-1949112IPR001356Homeobox domain
CDDcd000868.28E-1950109No hitNo description
PfamPF000461.4E-1751106IPR001356Homeobox domain
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.608.8E-493135IPR009057Homeodomain-like
PROSITE profilePS5084845.211232466IPR002913START domain
SuperFamilySSF559616.96E-39233465No hitNo description
CDDcd088756.85E-130236462No hitNo description
SMARTSM002342.4E-63241463IPR002913START domain
PfamPF018521.1E-55242463IPR002913START domain
Gene3DG3DSA:3.30.530.201.5E-6345463IPR023393START-like domain
SuperFamilySSF559614.12E-25483724No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MVEVPQQHDM SQCAESEIGK MREDEFESKS GSENLEGPSG DDQDPDRRPR KKRYHRHTQH  60
QIQEMEAFFK ECPHPDDKQR KELSRELGLE PLQVKFWFQN KRTQVKTQHE RHENAQLRAE  120
NEKLRTENMR YKEALNNASC PNCGGPTALG EMSFDEQHLR IENARLREEI DRISGIAAKY  180
VGKPMVSYPP LMAPLSRSPL DLGVGNFGVQ PNMGGEIYGG GDMVGRSMVG APELDKPMVI  240
ELAVAAMEEL IRMAQLGEPL WIPGVEDPTE VLCEEEYIRT FPRGIGPRPF GLKLEASRET  300
AVVIMNPINL VDILMDVNQW SSVFYGVISR AFTLDVFSTG VAGNYNGALQ VMSAEFQVPT  360
PLVPTRESYF VRYCKQHSDG TWAVVDVSLD SLRPSPQAMQ RCRRRPSGCL IHEMPNGYSK  420
VTWVEHVEVD DRAVHNIYRP LVNSGLAFGA KRWVATLDRQ CERLASVLAS NISARDLGVI  480
PSPEGRKSML KLAERMVVSF CAGVSASTAH TWTTLSGSGA EDVRVMTRKS IDDPGRPPGI  540
VLSAATSFWL PVPPKRVFDF LRDENSRSQW DILSNGGVVQ EMAHIANGPD PGNCVSLLRV  600
NSANSNQSNM LILQESCTDS SGSYVIYAPV DIVAMNVVLN GGDPDYVALL PSGFAILPDG  660
GLQPPSPSPQ SAPPAAAIGE VGFGGSLLTV AFQILVDSAP TAKLSLGSVA TVNSLIACTV  720
DRIKAAVTCE NA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826512.20.0PREDICTED: homeobox-leucine zipper protein ROC2 isoform X2
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLW1NEF50.0W1NEF5_AMBTC; Uncharacterized protein
STRINGVIT_12s0059g02310.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]